Typing of S. epidermidis samples (HDMx samples)

gene_x 0 like s 58 view s

Tags: processing

SCCmec_HDMs

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2786320/

Classification of Staphylococcal Cassette Chromosome mec (SCCmec): Guidelines for Reporting Novel SCCmec Elements

mec gene complex.

IS1272 is part of the IS1182 family of insertion sequences

  • The mec gene complex is composed of mecA, its regulatory genes, and associated insertion sequences.
  • The class A mec gene complex (class A mec) is the prototype complex, which contains mecA, the complete mecR1 and mecI regulatory genes upstream of mecA, and the hypervariable region (HVR) and insertion sequence IS431 downstream of mecA.
    • The class B mec gene complex is composed of mecA, a truncated mecR1 resulting from the insertion of IS1272 upstream of mecA, and [HVR and IS431 downstream of mecA].
  • The class C mec gene complex contains mecA and truncated mecR1 by the insertion of IS431 upstream of mecA and HVR and IS431 downstream of mecA.
  • There are two distinct class C mec gene complexes; in the class C1 mec gene complex, the IS431 upstream of mecA has the same orientation as the IS431 downstream of mecA (next to HVR), while in the class C2 mec gene complex, the orientation of IS431 upstream of mecA is reversed.
  • C1 and C2 are regarded as different mec gene complexes since they have likely evolved independently.
  • The class D mec gene complex is composed of mecA and ΔmecR1 but does not carry an insertion sequence downstream of ΔmecR1 (as determined by PCR analysis).

  • Several variants within the major classes of the mec gene complex have been described, including insertions of IS431 or IS1182 upstream of mecA in the class A mec gene complex or insertion of Tn4001 upstream of mecA in the class B mec complex.

  • run with bengal3

    cd ~/DATA/Data_Denise_CalCov1
cp bacto-0.1.json ../Data_Denise_CalCov2
cp cluster.json ../Data_Denise_CalCov2
cp Snakefile ../Data_Denise_CalCov2
ln -s /home/jhuang/Tools/bacto/local .
ln -s /home/jhuang/Tools/bacto/db .
ln -s /home/jhuang/Tools/bacto/envs .
mkdir raw_data; cd raw_data
ln -s ../Alignment_Imported_1/20240913_174420/Fastq/HDM7_S1_L001_R1_001.fastq.gz HDM7_R1.fastq.gz
ln -s ../Alignment_Imported_1/20240913_174420/Fastq/HDM7_S1_L001_R2_001.fastq.gz HDM7_R2.fastq.gz
ln -s ../Alignment_Imported_1/20240913_174420/Fastq/HDM10_S2_L001_R1_001.fastq.gz HDM10_R1.fastq.gz
ln -s ../Alignment_Imported_1/20240913_174420/Fastq/HDM10_S2_L001_R2_001.fastq.gz HDM10_R2.fastq.gz

ln -s ../20240812_FS10003086_50_BSB09416-2831/Alignment_Imported_1/20240813_202730/Fastq/HDM1_S1_L001_R1_001.fastq.gz HDM1_R1.fastq.gz
ln -s ../20240812_FS10003086_50_BSB09416-2831/Alignment_Imported_1/20240813_202730/Fastq/HDM1_S1_L001_R2_001.fastq.gz HDM1_R2.fastq.gz
ln -s ../20240913/Alignment_Imported_1/20240913_174420/Fastq/HDM7_S1_L001_R1_001.fastq.gz HDM7_R1.fastq.gz
ln -s ../20240913/Alignment_Imported_1/20240913_174420/Fastq/HDM7_S1_L001_R2_001.fastq.gz HDM7_R2.fastq.gz
ln -s ../20240913/Alignment_Imported_1/20240913_174420/Fastq/HDM10_S2_L001_R1_001.fastq.gz HDM10_R1.fastq.gz
ln -s ../20240913/Alignment_Imported_1/20240913_174420/Fastq/HDM10_S2_L001_R2_001.fastq.gz HDM10_R2.fastq.gz
ln -s ../20240919_FS10003086_61_BSB09416-2735/Alignment_Imported_1/20240920_173408/Fastq/HDM11-SF1_S1_L001_R1_001.fastq.gz HDM11-SF1_R1.fastq.gz
ln -s ../20240919_FS10003086_61_BSB09416-2735/Alignment_Imported_1/20240920_173408/Fastq/HDM11-SF1_S1_L001_R2_001.fastq.gz HDM11-SF1_R2.fastq.gz
ln -s ../20240919_FS10003086_61_BSB09416-2735/Alignment_Imported_1/20240920_173408/Fastq/HDM15-SF2_S2_L001_R1_001.fastq.gz HDM15-SF2_R1.fastq.gz
ln -s ../20240919_FS10003086_61_BSB09416-2735/Alignment_Imported_1/20240920_173408/Fastq/HDM15-SF2_S2_L001_R2_001.fastq.gz HDM15-SF2_R2.fastq.gz

# only activate the steps assembly and mlst in bacto-0.1.json.
(bengal3_ac3) jhuang@WS-2290C:~/Documents$ /home/jhuang/miniconda3/envs/snakemake_4_3_1/bin/snakemake --printshellcmds

# -- Results --
shovill/HDM1/contigs.fa sepidermidis    5       arcC(1) aroE(1) gtr(1)  mutS(2) pyrR(2) tpiA(1) yqiL(1)
HDM10.mlst.txt:shovill/HDM10/contigs.fa sepidermidis    59      arcC(2) aroE(1) gtr(1)  mutS(1) pyrR(2) tpiA(1) yqiL(1)
HDM7.mlst.txt:shovill/HDM7/contigs.fa   sepidermidis    59      arcC(2) aroE(1) gtr(1)  mutS(1) pyrR(2) tpiA(1) yqiL(1)

  • run with bakta

    #under env (bakta)
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
    bakta --db /mnt/nvme0n1p1/bakta_db shovill/${sample}/contigs.fa --prefix ${sample}
done

  • mapping on assembly to calculate the coverage

    #samtools depth input.bam > depth.txt
#samtools depth input.bam | awk '{sum+=$3} END { print "Average coverage:",sum/NR}'
#bedtools coverage -a regions.bed -b input.bam > coverage.txt
#bedtools coverage -a regions.bed -b input.bam -d > coverage_per_base.txt

bwa index ./shovill/HDM1/contigs.fa
bwa mem ./shovill/HDM1/contigs.fa fastq/HDM1_1.fastq fastq/HDM1_2.fastq > aligned.sam
samtools view -Sb aligned.sam > aligned.bam
samtools sort aligned.bam -o sorted.bam
samtools index sorted.bam
samtools depth sorted.bam > depth.txt
awk '{sum+=$3} END { print "Average coverage:",sum/NR}' depth.txt
bedtools coverage -a regions.bed -b sorted.bam > coverage.txt
bedtools genomecov -ibam sorted.bam -d > coverage_per_base.txt

# Step 1: Calculate depth using samtools
samtools depth sorted.bam > depth.txt
# Step 2: Calculate average depth using awk
awk '{sum+=$3; count++} END {print "Average Coverage:", sum/count}' depth.txt

# Step 1: Calculate coverage with bedtools for a BED file
#bedtools coverage -a regions.bed -b input.bam > coverage.txt
# Step 2: Process the output with awk
#awk '{ sum+=$7 } END { print "Average coverage depth:", sum/NR }' coverage.txt

bwa index ./shovill/HDM7/contigs.fa
bwa mem ./shovill/HDM7/contigs.fa fastq/HDM7_1.fastq fastq/HDM7_2.fastq > aligned_HDM7.sam
samtools view -Sb aligned_HDM7.sam > aligned_HDM7.bam
samtools sort aligned_HDM7.bam -o sorted_HDM7.bam
samtools index sorted_HDM7.bam
# Step 1: Calculate depth using samtools
samtools depth sorted_HDM7.bam > depth_HDM7.txt
# Step 2: Calculate average depth using awk
awk '{sum+=$3; count++} END {print "Average Coverage:", sum/count}' depth_HDM7.txt
#Average Coverage: 380.079

bwa index ./shovill/HDM10/contigs.fa
bwa mem ./shovill/HDM10/contigs.fa fastq/HDM10_1.fastq fastq/HDM10_2.fastq > aligned_HDM10.sam
samtools view -Sb aligned_HDM10.sam > aligned_HDM10.bam
samtools sort aligned_HDM10.bam -o sorted_HDM10.bam
samtools index sorted_HDM10.bam
# Step 1: Calculate depth using samtools
samtools depth sorted_HDM10.bam > depth_HDM10.txt
# Step 2: Calculate average depth using awk
awk '{sum+=$3; count++} END {print "Average Coverage:", sum/count}' depth_HDM10.txt
#Average Coverage: 254.704

  • SCCmec typing and drawing with clinker

    #1. -- HDM1_contigs.fa --

One SCCmec element detected.

Prediction based on genes:
Predicted SCCmec element: SCCmec_type_IV(2B)

Prediction based on homology to whole cassette:
Predicted whole cassette and %template coverage: SCCmec_type_IV(2B) 79.92%

Predicted genes:
Fasta header % Identity Query/HSP Length Contig Position in contig

ccrA2:7:81108:AB096217  100.00  1350/1350   contig00032 3770..5119
ccrB2:9:JCSC4469:AB097677   99.94   1650/1650   contig00032 5120..6769
IS1272:3:AM292304   99.95   1844/1843   contig00032 8611..10454
dmecR1:1:AB033763   100.00  987/987 contig00032 10443..11429
mecA:12:AB505628    100.00  2010/2010   contig00032 11526..13535

samtools faidx shovill/HDM1_contigs.fa
samtools faidx shovill/HDM1_contigs.fa contig00032:1-13635 > HDM1_sub.fna
bakta --db /mnt/nvme0n1p1/bakta_db HDM1_sub.fna

#2. -- HDM7_contigs.fa --

One SCCmec element detected.

Prediction based on genes:
Predicted SCCmec element: SCCmec_type_IVa(2B)

Prediction based on homology to whole cassette:
Predicted whole cassette and %template coverage: SCCmec_type_IVa(2B) 84.24%

Predicted genes:
Fasta header % Identity Query/HSP Length Contig Position in contig

mecA:12:AB505628    100.00  2010/2010   contig00014 2800..4809
dmecR1:1:AB033763   99.90   987/987 contig00014 4906..5892
IS1272:3:AM292304   100.00  1843/1843   contig00014 5881..7723
ccrB2:3:CA05:AB063172   100.00  1629/1629   contig00014 9565..11193
ccrA2:3:CA05:AB063172   100.00  1350/1350   contig00014 11215..12564
subtype-IVa(2B):1:CA05:AB063172 100.00  1491/1491   contig00014 16461..17951
#IS1272:2:AB033763  91.06   1577/1585   contig00001 369260..370836

samtools faidx shovill/HDM7_contigs.fa
samtools faidx shovill/HDM7_contigs.fa contig00014:2700-18051 > HDM7_sub.fna
bakta --db /mnt/nvme0n1p1/bakta_db HDM7_sub.fna

mecA
dmecR1
Type I restriction enzyme HindI endonuclease subunit-like C-terminal domain-containing protein
IS1272
DUF1643 domain-containing protein
Pyridoxal phosphate-dependent enzyme
hypothetical protein
ccrB2
ccrA2
DUF927 domain-containing protein
hypothetical protein
ACP synthase
AAA family ATPase (= subtype-IVa(2B))

#3. -- HDM10_contigs.fa --

Prediction based on genes:
Predicted SCCmec element: SCCmec_type_IV(2B&5)

Prediction based on homology to whole cassette:
Predicted whole cassette and % template coverage: SCCmec_type_IV(2B) 84.37%

Predicted genes:

Fasta header % Identity Query/HSP Length Contig Position in contig

subtype-IVa(2B):1:CA05:AB063172 100.00  1491/1491   contig00020 4152..5642
ccrA2:3:CA05:AB063172   100.00  1350/1350   contig00020 9539..10888
ccrB2:3:CA05:AB063172   100.00  1629/1629   contig00020 10910..12538
IS1272:3:AM292304   100.00  1843/1843   contig00020 14380..16222
dmecR1:1:AB033763   100.00  987/987 contig00020 16211..17197
mecA:12:AB505628    100.00  2010/2010   contig00020 17294..19303
#IS1272:2:AB033763  90.75   1579/1585   contig00033 2..1580
#ccrC1-allele-2:1:AB512767  90.95   1680/1680   contig00022 9836..11515

samtools faidx shovill/HDM10_contigs.fa
samtools faidx shovill/HDM10_contigs.fa contig00020:4052-19403 > HDM10_sub.fna
bakta --db /mnt/nvme0n1p1/bakta_db HDM10_sub.fna

#4. -- HDM11-SF1_contigs.fa --

No SCCmec element was detected

Prediction based on genes:
Predicted SCCmec element: none

Prediction based on homology to whole cassette:
Predicted whole cassette and %template coverage: none

#5. -- HDM15-SF2_contigs.fa --

SCCmec_type_IV(2B)
SCCmec_type_VI(4B)
Following gene complexes based on prediction of genes was detected :
ccr class 2
ccr class 4
mec class B

Predicted genes:
Fasta header % Identity Query/HSP Length Contig Position in contig

ccrA2:7:81108:AB096217  100.00  1350/1350   contig00004 3823..5172
ccrB2:9:JCSC4469:AB097677   99.94   1650/1650   contig00004 5173..6822
IS1272:3:AM292304   99.95   1844/1843   contig00004 8664..10507
dmecR1:1:AB033763   100.00  987/987 contig00004 10496..11482
mecA:12:AB505628    100.00  2010/2010   contig00004 11579..13588

subtyppe-Vc(5C2&5):10:AB505629  99.84   1935/1935   contig00004 20148..22082

ccrA4:2:BK20781:FJ670542    90.53   1362/1362   contig00004 24570..25931
ccrB4:2:BK20781:FJ670542    91.68   1635/1629   contig00004 25928..27562

subtype-IVa(2B):1:CA05:AB063172 100.00  1491/1491   contig00015 52228..53718

samtools faidx shovill/HDM7_contigs.fa
samtools faidx shovill/HDM7_contigs.fa contig00014:2700-18051 > HDM7_sub.fna
bakta --db /mnt/nvme0n1p1/bakta_db HDM7_sub.fna

samtools faidx shovill/HDM10_contigs.fa
samtools faidx shovill/HDM10_contigs.fa contig00020:4052-19403 > HDM10_sub.fna
bakta --db /mnt/nvme0n1p1/bakta_db HDM10_sub.fna

samtools faidx shovill/HDM15-SF2_contigs.fa
samtools faidx shovill/HDM15-SF2_contigs.fa contig00004:1-27662 > HDM15-SF2_sub.fna
samtools faidx shovill/HDM15-SF2_contigs.fa contig00015:52128-53818 >> HDM15-SF2_sub.fna
bakta --db /mnt/nvme0n1p1/bakta_db HDM15-SF2_sub.fna

#END
#172.104.140.19

mkdir gbff_sub
mv *_sub.gbff gbff_sub
cd gbff_sub
for f in *_sub.gbff; do mv "$f" "${f/_sub.gbff/.gbff}"; done
#mv HDM1_sub.gbff HDM1.gbff
#mv HDM7_sub.gbff HDM7.gbff
#mv HDM10_sub.gbff HDM10.gbff
#mv HDM15-SF2_sub.gbff HDM15-SF2.gbff

rm *.json
clinker *.gbff -p plot_HDRNA.html --dont_set_origin -s session_HDRNA.json -o alignments_HDRNA.csv -dl "," -dc 4

cp ./gbff_HDRNA_01/clinker.png HDRNA_01_clinker.png

  • Arg typing

    grep "agrD" *.gbff | sort

HDM1.gbff:                     /gene="agrD"
HDM1.gbff:                     /gene="agrD"
HDM7.gbff:                     /gene="agrD"
HDM7.gbff:                     /gene="agrD"
HDM10.gbff:                     /gene="agrD"
HDM10.gbff:                     /gene="agrD"
HDM11-SF1.gbff:                     /gene="agrD"
HDM11-SF1.gbff:                     /gene="agrD"
HDM15-SF2.gbff:                     /gene="agrD"
HDM15-SF2.gbff:                     /gene="agrD"

MNLLGGLLLKIFSNFMAVIGNASKYNPCSNYLDEPQVPEELTKLDE
MENIFNLFIKFFTTILEFIGTVAGDSVCASYFDEPEVPEELTKLYE
MENIFNLFIKFFTTILEFIGTVAGDSVCASYFDEPEVPEELTKLYE
MNLLGGLLLKIFSNFMAVIGNASKYNPCSNYLDEPQVPEELTKLDE
MNLLGGLLLKIFSNFMAVIGNASKYNPCSNYLDEPQVPEELTKLDE

#* The agr typing is not defined, as I have compared the sequence with the amino acid sequences of ArgD described in the paper available at https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4187671/. It does not correspond to Type I, Type II, or Type III. (For more details, see below).

-- AgrD I --
Query  1       MENIFNLFIKFFTTILEFIGTVAGDSVCASYFDEPEVPEELTKLYE  46
        M  +  L +K F+  +  IG  +  + C  Y DEP+VPEELTKL E
Sbjct  926825  MNLLGGLLLKIFSNFMAVIGNASKYNPCVMYLDEPQVPEELTKLDE  926688

-- AgrD II --
Query  1       MNLLGGLLLKIFSNFMAVIGNASKYNPCSNYLDEPQVPEELTKLDE  46
        MNLLGGLLLKIFSNFMAVIGNASKYNPC  YLDEPQVPEELTKLDE
Sbjct  926825  MNLLGGLLLKIFSNFMAVIGNASKYNPCVMYLDEPQVPEELTKLDE  926688

-- AgrD III --
Query  1       MNLLGGLLLKLFSNFMAVIGNAAKYNPCASYLDEPQVPEELTKLDE  46
        MNLLGGLLLK+FSNFMAVIGNA+KYNPC  YLDEPQVPEELTKLDE
Sbjct  926825  MNLLGGLLLKIFSNFMAVIGNASKYNPCVMYLDEPQVPEELTKLDE  926688

  • calulate the presence-absence-matrix for predefined gene list

    #start codon: ATG, GTG und TTG
#stop codon: 5'-UAA-3', 5'-UGA-3' und 5'-UAG-3' --> TAA, TGA, TAG

./Staphylococcus_aureus_MRSA252.fasta
./Staphylococcus_epidermidis_RP62A.fasta
./Enterococcus_faecium_isolate_E300_pathogenicity_island.fasta

# -- Hause keeper: gyrB --
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":2609812-2611743 > gyrB.fasta
#revcomp gyrB.fasta > gyrB_revcomp.fasta
gyrB_revcomp.fasta

# -- Metabolic genes: fumC, gltA, icd --
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":1444326-1445711 > fumC.fasta
#revcomp fumC.fasta > fumC_revcomp.fasta
./fumC_revcomp.fasta
./gltA.fasta
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":1296195-1297463 > icd.fasta
#revcomp icd.fasta > icd_revcomp.fasta
icd_revcomp.fasta

# -- Virulence regulartors: apsS, sigB, sarA, agrC, yycG --
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":316151-317191 > apsS.fasta
apsS.fasta
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":1722805-1723575 > sigB.fasta
#revcomp sigB.fasta > sigB_revcomp.fasta
sigB_revcomp.fasta
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":279424-279798 > sarA.fasta
#revcomp sarA.fasta > sarA_revcomp.fasta
sarA_revcomp.fasta
./agrC.fasta
./yycG.fasta

# -- Toxins: psmβ1, hlb --
./psm-beta.fasta
#psm-beta1.fasta
./hlb_.fasta
#./hlb.fasta

# -- Biofilm formation: atlE, sdrG, sdrH, ebh, ebp, tagB --
./atlE.fasta
./sdrG.fasta

#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":1555024-1556469 > sdrH.fasta
#revcomp sdrH.fasta > sdrH_revcomp.fasta
sdrH_revcomp.fasta

#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":1023531-1053980 > ebh.fasta
#revcomp ebh.fasta > ebh_revcomp.fasta
ebh_revcomp.fasta

#https://www.ncbi.nlm.nih.gov/gene/?term=(Elastin-binding+protein)+AND+%22Staphylococcus+aureus%22%5Bporgn%3A__txid1282%5D
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":1094204-1095586 > ebpS.fasta
#revcomp ebpS.fasta > ebpS_revcomp.fasta
ebpS_revcomp.fasta
./tagB.fasta

# -- Immune evasion & colonization: capC, sepA, dltA, fmtC, lipA, sceD, SE0760 --

./capC.fasta
#./capBCA_ywtC.fasta
./sepA.fasta
#./ORF123_sepA_ORF5.fasta

#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":503173-504630 > dltA.fasta
dltA.fasta
./fmtC.fasta
#samtools faidx Staphylococcus_epidermidis_RP62A.fasta "gi|57865352|ref|NC_002976.3|":498445-499359 > lipA.fasta
lipA.fasta
./sceD.fasta
#./sceDAE.fasta
./SE0760.fasta

# -- Serine protease: esp, ecpA --
./esp.fasta
./ecpA_.fasta
#./ecpA.fasta

# -- Phage: PhiSepi-HH1, PI-Sepi-HH2, PhiSepi-HH3 (#HH1-HP1, HH3-HP2, HH3-TreR) --
./MT880870.fasta
./MT880871.fasta
./MT880872.fasta

#Note that write a message to Holger, say "ebp gene does not exist, instead of it only ebpS gene exists!"

makeblastdb -in HDM1_contigs.fa -dbtype nucl
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query gyrB_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > gyrB_on_${sample}.blastn
done

./fumC_revcomp.fasta
./gltA.fasta
icd_revcomp.fasta

for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query fumC_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > fumC_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query gltA.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > gltA_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query icd_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > icd_on_${sample}.blastn
done

for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query apsS.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > apsS_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query sigB_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > sigB_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query sarA_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > sarA_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query agrC.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > agrC_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query yycG.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > yycG_on_${sample}.blastn
done

for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query psm-beta.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > psm-beta_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query psm-beta1.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > psm-beta1_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query hlb_.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > hlb_on_${sample}.blastn
done

for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query atlE.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > atlE_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query sdrG.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > sdrG_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query sdrH_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > sdrH_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query ebh_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > ebh_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query ebpS_revcomp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > ebpS_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query tagB.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > tagB_on_${sample}.blastn
done

for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query capC.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > capC_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query sepA.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > sepA_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query dltA.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > dltA_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query fmtC.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > fmtC_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query lipA.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > lipA_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query sceD.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > sceD_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query SE0760.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > SE0760_on_${sample}.blastn
done

# -- Serine protease: esp, ecpA --
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query esp.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > ./esp_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query ecpA_.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > ecpA_on_${sample}.blastn
done

# -- Phage: PhiSepi-HH1, PI-Sepi-HH2, PhiSepi-HH3 (#HH1-HP1, HH3-HP2, HH3-TreR) --
#34053 (3000,2510) 36164 (500) 147057 (6618, 15237+3812, 15237+3812, 15233+3814, 15230+3812)
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query MT880870.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > ./MT880870_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query MT880871.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > ./MT880871_on_${sample}.blastn
done
for sample in HDM1 HDM7 HDM10 HDM11-SF1 HDM15-SF2; do
  blastn -db ../shovill/${sample}_contigs.fa -query MT880872.fasta -evalue 1e-50 -num_threads 15 -outfmt 6 -strand both -max_target_seqs 1 > MT880872_on_${sample}.blastn
done

like unlike

点赞本文的读者

还没有人对此文章表态

本文有评论

没有评论

看文章，发评论，不要沉默

最受欢迎文章

  1. Why Do Significant Gene Lists Change After Adding Additional Conditions in Differential Gene Expression Analysis?
  2. Updating Human Gene Identifiers using Ensembl BioMart: A Step-by-Step Guide
  3. Setup conda environments
  4. 洛那法尼(lonafarnib)：从抗癌症到抗病毒的多功能药物
  5. pheatmap vs heatmap.2
  6. RNAseq running with umi_tools
  7. Motif Discovery in Biological Sequences: A Comparison of MEME and HOMER
  8. File format for single channel analysis of Agilent microarray data with Limma?
  9. Guide to Submitting Data to GEO (Gene Expression Omnibus)
  10. The top 10 genes

最新文章

最多评论文章

推荐相似文章

Configuring Mutt for Gmail: A Step-by-Step Guide (Todo)

Using deepARG to detect Antibiotic Resistance Genes (ARGs)

Enriching Monkeypox virus using xGen™ Monkeypox Virus Amplicon Panel

MicrobiotaProcess for GPA vs control

© 2023 XGenes.com Impressum